घर - दूर. COM

  • 2021-12-31संग्रहण दिनांक
  • 2022-02-15अद्यतन
घर - दूर. COM
  • वेबसाइट का पता:www.dawn.com
  • सर्वर आईपी:172.67.144.15
  • स्थल का वर्णन:पाकिस्तान और दुनिया के सबसे अन्तिम और टॉप समाचार के लिए जाँच करें

डोमेन नाम:www.dawn.comमूल्यांकन

के बारे में 500000~10000000

डोमेन नाम:www.dawn.comबहे

366

डोमेन नाम:www.dawn.comअच्छा या बुरा

जी झोंग बुराई लाता है। आगे रहना बेहतर है सौभाग्य बुराई की ओर ले जाता है

वेबसाइट:घर - दूर. COMतौल

2

वेबसाइट:घर - दूर. COMIP

172.67.144.15

वेबसाइट:घर - दूर. COMसामग्री

Home-DAWN.COM{"@context":"http:\/\/schema.org","@type":"organization","logo":":\/\/\/_img\/logo.png","name":"DAWN.COM","url":":\/\/","sameAs":[":\/\/\/dawndotcom\/",":\/\/twitter.com\/dawn_com",":\/\/\/dawn_dot_com\/",""],"potentialAction":{"@type":"SearchAction","target":":\/\/\/search?cx=:a1i8yd7zymy&ie=UTF-8&q={search_term_string}","query-input":"requiredname=search_term_string"}}vargooglet=googlet||{};googlet.cmd=googlet.cmd||[];googleAdsSlots=[];googlet.cmd.push(function(){googleAdsSlots.push(googlet.defineSlot('//DAWN-ASA-DESKTOP-TOP',[[728,90],[970,90],[970,250]],'div-gpt-ad-17-0').addService(googlet.pubads()));googleAdsSlots.push(googlet.defineSlot('//DAWN-LB-728x90-BOTTOM',[728,90],'div-gpt-ad-29-0').addService(googlet.pubads()));googleAdsSlots.push(googlet.defineSlot('//DAWN-MREC-DESKTOP-300x250-TOP',[[300,250],[336,280]],'div-gpt-ad-00-3').addService(googlet.pubads()));googleAdsSlots.push(googlet.defineSlot('//DAWN-FLIMSTRIP-300x600',[[300,250],[300,600],[160,600]],'div-gpt-ad-29-0').addService(googlet.pubads()));googleAdsSlots.push(googlet.defineSlot('//DAWN-MREC-DESKTOP-300x250-2',[300,250],'div-gpt-ad-00-5').addService(googlet.pubads()));googleAdsSlots.push(googlet.defineSlot('//DAWN-MREC-MOBILE-300x250-TOP',[300,250],'div-gpt-ad-00-4').addService(googlet.pubads()));googleAdsSlots.push(googlet.defineSlot('//DAWN-LB-728x90-MIDDLE',[728,90],'div-gpt-ad-00-2').addService(googlet.pubads()));googleAdsSlots.push(googlet.defineSlot('//DAWN-STICKY-MOBILE-320x50',[320,50],'div-gpt-ad-24-0').addService(googlet.pubads()));googleAdsSlots.push(googlet.defineSlot('//DAWN-STICKY-DESKTOP-728x60',[[728,90],[728,60]],'div-gpt-ad-03-0').addService(googlet.pubads()));googleAdsSlots.push(googlet.defineSlot('//DAWN-ASA-MOBILE-TOP',[[320,50],[728,90],[320,100]],'div-gpt-ad-21-0').addService(googlet.pubads()));googleAdsSlots.push(googlet.defineSlot('//DAWN-STICKY-DESKTOP-1x1',[1,1],'div-gpt-ad-79-0').addService(googlet.pubads()));googleAdsSlots.push(googlet.defineSlot('//DAWN-STICKY-MOBILE-1x1',[1,1],'div-gpt-ad-99-0').addService(googlet.pubads()));googlet.pubads().set("document_langue","en");googlet.pubads().collapseEmptyDivs();googlet.pubads().setTargeting('site','');googlet.pubads().setTargeting('category','Home');googlet.pubads().disableInitialLoad();googlet.pubads().enableLazyLoad({fetchMarginPercent:300,renderMarginPercent:300,mobileScaling:2.0})googlet.enableServices();});functionrender(divId){if(!divId){console.log('Error:Adnotfounddivid:'+divId);return;}varcookieValue=";"+document.cookie;varcookieParts=cookieValue.split(";"+divId+"=");if(cookieParts.pop().split(';').shift()!=divId){googlet.cmd.push(function(){googlet.display(divId)});}else{varadContainer=document.getElementById(divId).closest('.ad');adContainer.classList.remove('block','sm:block');adContainer.classList.add('hidden');}}varsetupGoogleAdsInterval=setInterval(function(){if(typeofgooglet!='undefined'&&typeofjQuery!='undefined'){clearInterval(setupGoogleAdsInterval);setupGoogleAds();}},100);functionsetupGoogleAds(){googlet.cmd.push(function(){for(i=0;i=30){setTimeout(function(){googlet.pubads().refresh([slot]);},refreshTime*1000);}});//httpstackoverflow.com/a///developers.google.com/doubleclick-gpt/reference#googlet.events.SlotRenderEndedEvent//itisrequiredassometimesrenderedadisemptybutradaddswidthandheightonthediv//whichdoesn'tallowtheadtocollapseinthiscasegooglet.pubads().addEventListener('slotRenderEnded',function(e){var$renderedSlot=$('#'+e.slot.getSlotElementId());if(e.isEmpty){$renderedSlot.parents('.ad').attr("style","display:none!important");}else{//seeissues#/836//multidimensionadsradinit,aswedon'tknowwhichadisrenderedso//wegetthedimensionsofrenderedadandthenconfigureitwithradvarwidth=0;varheight=0;varisMultidimensionalAd=$renderedSlot.parents('.ad').find('.rad--multi').length>0;varisPriorityAd=$renderedSlot.parents('.ad').hasClass('ad--priority');if(e.size.length){width=e.size[0];height=e.size[1];}if(isMultidimensionalAd){if(width&&height){$renderedSlot.css({width:width+'px',height:height+'px'});$renderedSlot.closest('.js-ad').css({maxWidth:width+'px',maxHeight:height+'px',paddingBottom:0});$renderedSlot.rad({allowBiggerSizing:'true'});}}if(isPriorityAd){if(width&&height){varonMouseOut="jascript:this.style.overflow='hidden';"+"__adi=$(this).find('iframe').eq(0);"+"__adi.height(height);";varonMouseOver="jascript:this.style.overflow='visible';"+"__adi=$(this).find('iframe').eq(0);"+"__adi.contents().height();"//weird,addingthisfixesFirefoxexpandingissue+"setTimeout(function(){__adi.height(__adi.contents().height()||height);},10);";$renderedSlot.parents('.js-ad').attr('onMouseOver',onMouseOver);$renderedSlot.parents('.js-ad').attr('onMouseOut',onMouseOut);}}if($renderedSlot.parents('.ad').hasClass('ad--closable')){$renderedSlot.parents('.ad').removeClass('ad--closable').addClass('ad--ready-for-closing');}}});});}window.onload=function(){//developers.google.com/doubleclick-gpt/reference#googlet.apiReadyif(typeofgooglet.apiReady=='undefined'){$('.ad').attr('style','display:none!important');}}window.dataLayer=window.dataLayer||[];functiongt(){dataLayer.push(arguments);}gt('js',newDate());gt('set','dimension1','Home');gt('config','G-C521GRS8DF',{'custom_map':{"dimension1":"Category"}});gt('config','UA--1',{'custom_map':{"dimension1":"Category"}});gt('event','custom',{"Category":"Home"});EPAPERLIVETVDAWNNEWSURDUImesHeraldAuroraCityFM89TeeliAdvertiseEvents/SupplementsClassifiedsObituariesDAWN.COMToday'sPaper| FloodDonations |December02,2022HomeLatestPakistanOpinionBusinessWorldCulturePrismSportMazinesTechPopularArchiveHomeLatestPakistanOpinionBusinessWorldCulturePrismSportMazinesTechPopularArchiveSearchPTIsaysAzamSwati‘takenaway’byQuettapolicefromIslamabadFormerpremierImranKhansaysthesenatorwasmovedtoPimslastnightafterbreathingissues,callsforSwati's"immediaterelease".Updated02Dec,202202:21pmRelatedIslamabadcourtsendsAzamSwatitojailon14-dayjudicialremandAzamSwatiurgesSCtotransferallcasesainsthimtocapitalSenatorSwatiremandedtoFIAfor2daysover'highlyobnoxious'tweetsainstmilitaryofficialsFormerCOASBajwaadvisedPML-QtosupportPTIduringno-trustvote,claimsMoonisCondemnscriticismofformerarmychief;says"hadhebeenthatbad,whywouldheheaskedustosidewiththem(PTI)".Updated02Dec,202212:18pmUnder-pressurePakistan17-0atlunchafterEngland’smammoth657Englandadded151runstothescoreboardearlierinthedaybeforebeingdismissedfor657.Published02Dec,202202:20pmEx-envoytoUSAsadMajeedappointedforeignsecretary"AsadMajeedKhanhasbeenpostedasSecretary,ForeignAffairsDivision,withimmediateeffectanduntilfurtherorders,"saysnotification.Updated02Dec,202202:12pmVeteranjournalistImranAslampassesawayat70HehadbeenunwellforsometimeandwasundergoingtreatmentatahospitalinKarachi,saysreport.Updated02Dec,202202:40pm3ANFofficialssuspendedaftervideoemergesofthemallegedlytakingbribesatIslamabadairportANFlaunches"high-levelinquiry"toascertainfacts.Published02Dec,202208:48amUSbrandsSouthAsianAl-Qaeda,TTPmilitantsasglobalterroristsAntonyBlinkensaysdesignationsarea"partofrelentlesseffortstoensureterroristsdon'tuseAfghanistanforinternationalterrorism".Published02Dec,202210:53amNoformaltalksorreementwithTTP,saysRanaSanaullahAmid‘alarming’riseinterrorism,interiorministersaysdialoguewithbannedoutfitonlypossibleiftheylaydownarms.Updated02Dec,202207:38amOnekilledinattackonSouthWaziristangirlsschoolSecurityofficialinjured;policesayunknownmilitantsopenedfireatArmyPublicSchoolforGirlsduringParents’Daycelebrations.Updated02Dec,202207:47amMalikRiazlatesttobenefitfromNAOtweaksGetsoffscot-freeinBahriaIconTowerreferenceasaccountabilitycourtreturnscasecitinglackofjurisdiction.Updated02Dec,202208:19amREADMORETOPSTORIESDAWNNEWSENGLISHCanRaisingImportDutiesBoostPakistan’sExports?DispatchfromWashington:US,PakistanpartneringtofightterrorismDarresponsiblefor2018balanceofpaymentscrisisWillRahulGandhi’sbidto“Bharatjodo”succeed?CanrooftopsolarpanelshelpPakistanreduceemissions?MUSTREADSTORIESCOP27:Shouldwereallybecelebratingthe‘lossanddame’fundasalandmarkachievement?Editorial:ItisabitrichforImrantobesermonisingwhenheasksnewmilitaryleadershiptoend'trustdeficit'ImranAslam—ThenervousvisionaryPakistaneconomyisafflictedwithseveralweaknesses,oneofwhichisDutchdiseaseKiranaurGeorgekaPakistanAmiduproaronsocialmedia,NetflixreleasesJordanianfilmFarhaonforcedevictionofPalestiniansin1948KarachiisindireneedofanindependentpoliceforcetostemlawlessnessandgrowingcrimerateGoinglocoforlocal:Ifyoudigminimalistaesthetic,NatashaZubairStationeryistheplaceforyouEditorial:Postceasefireend,thestatemustnotignoretheemergingthreatofTTPmilitancyandstrikenow‘IlikeHitler’:KanyeWestdoublesdownonanti-semitisminwildInfowarsstreamPakistan’sestablishmentneedstodosomeserioussoul-searchingaboutthecountry’splaceintheworldInsidetheunderbellyofKarachiTopAuthorsTahirKhanMiftahIsmailZulqernainTahirAnwarIqbalTahirSheraniOVERLAST3DAYSMOSTPOPULAROverlast24hours1ChristiansnowaminorityinEnglandandWales,censusreleasedThecensusshowsrapidgrowthamongtheMuslimpopulation.Newspaper,Updated30Nov,202209:36am2BeijingreliesonPakistantoprojectitsmight,PentonreportnotesChinaMilitaryPowernotesthatBeijingranksIslamabadasitsonly‘all-weatherstrategicpartner’,aheadofMoscow.World,Updated01Dec,202208:28am3FinaldecisionongoingaheadwithfirstPakvsEngTestdelayedtilltomorrowInjointstatement,PCBandECBsaytheydiscussedthe“outbreakofviralinfection”amongtheEnglandcamp.,Updated01Dec,202208:26am4Bilawaldisputes‘politicalfailure’narrativeon1971debacleTermsfallofDhaka‘militaryfailure’;saysPTIwillneverresignfromKPandPunjabassembliesNewspaper,Updated01Dec,202207:44am5Khan’snewwargameDissolutionoftheassembliesinPunjabandKPwilldeepenthepoliticalcrisis.Newspaper,Published30Nov,202208:00amOPINIONOurDutchdiseaseItisbadpolicieswhichactasacurseandconstraintherealisationofbenefitsfromresources.RiazRiazuddinKarachistreetcrimeAfzalAliShigriAbeautifulmindZubeidaMustafaProductiveconflictMuhammadKhudadadChatthaExploitingclimatediplomacyAliTauqeerSheikhEDITORIALWaywardideologyAnyonewhoclaimshislegacyforthemselvesshouldnottreathiswordssowhimsically.ProgressivestanceTHEtimingoftwoencouringdevelopmentsinthefightainstdomesticviolenceinPakistancouldnothebeen...ChinaCovidprotestsPUBLICprotestsarerareinChinawherethePeople’sRepublicmaintainsorderthroughastrictauthoritariancode...Today'sToonPOPULAROPEDWRITERSOverlast24hours1.ZahidHussainKhan’snewwargameDissolutionoftheassembliesinPunjabandKPwilldeepenthepoliticalcrisis.2.TouqirHussainFreeordependent?Aweakstateendsupwithaforeignpolicyservingothers’interests.3.MiftahIsmailAconsistentdownwardslideTherecomesatimewhenthenationalinterestmustprevailoverpoliticalinterest.4.MahirAliGeneralamnesiaDubiouघर - दूर. COMslegacieshebeenleftbehindbydepartingchiefs.5.AliTauqeerSheikhExploitingclimatediplomacyClimatediplomacyisdrivenbyfaithinprolongedengementincomplexprocesses.BUSINESSExportsshrinkforthirdmonthinarowReservesdown4.2pc;rupeegains11-membercommissionsetuptoadviseonresourcemobilisationHascolseekscreditors’consenttoloanrestructuring‘Procurement’ruleshurdletoqualityprojects:SenatepanelHeadlineinflationeasesmarginallyto23.8pcinNovemberSPORTUnder-pressurePakistan17-0atlunchafterEngland’smammoth657FIFAWorldCup2022:GermanycrashoutasJapan,SpainadvancePenaltymissmadeArgentinastronger,saysMessiFIFA-AFCdelegationtovisitPakistannextmonthLabuschne,SmithheapmiseryontiringWestIndiesFIFAWorldCup2022:BelgiumcrashoutaftergoallessdrawwithModric’sCroatiaWORLDUSbrandsSouthAsianAl-Qaeda,TTPmilitantsasglobalterroristsUNurgesTalibantoinvestigatereportsofextrajudicialkillingsIndianSupremeCourttohearBilkisrapecaseainMacronraisessubsidiesforUSgoodsatsummitwithBidenChinasoftenstoneonCovidseverityafterprotestsVanuatutorelocatevillesduetorisingseaAmiduproaronsocialmedia,NetflixreleasesJordanianfilmFarhaonforcedevictionofPalestiniansin1948ImesStaffPublished02Dec,202202:19pmGoinglocoforlocal:Ifyoudigminimalistaesthetic,NatashaZubairStationeryistheplaceforyouMadefromrecycledpaper,theirproductsaresustainablewithnocompromiseonquality.SoomalHaleemPublished02Dec,202201:16pm‘IlikeHitler’:KanyeWestdoublesdownonanti-semitisminwildInfowarsstream"TheNaziswerethugsanddidreallybadthings.Buttheydidgoodthingstoo.WegottastopdissingtheNazisallthetime…IloveNazis,”Westsaid.AFPPublished02Dec,202210:47amCOP27:Shouldwereallybecelebratingthe‘lossanddame’fundasalandmarkachievement?AzwarShakeelPublished02Dec,202201:58pmThelegacyofGenQamarJedBajwaAfterspendingsixyearsasPakistan’smostpowerfulman,GenBajwaleesbehindacountryatoddswithitself,andadriftglobally.UzairM.YounusUpdated23Nov,202201:05pmIsJoyland’scrimethatitmirrorssocietytoafault?FilmslikeJoylandarebannedbecause'ime-conscious'countrieslikePakistanheplentyofskeletonsinthecloset.FahadNeedUpdated21Nov,202212:21pmTECHMuskhopefulofinterfaceimplantsinhumanbrainswithinsixmonthsAFPUpdated02Dec,202209:28amMechanismtobedevisedforpaymentsainstGoogleappservices:ITministerAminulHaqueassuresthataftermechanismisdevised,paymentwillbemadetoGoogleaspertheschedule.AbdullahMomandPublished01Dec,202202:24pmElonMuskaccusesAppleofpullingTwitterfromappstoreClaimsAppleispressuringTwitterovercontentmoderationdemands.ReutersUpdated30Nov,202208:34amINSIDETHEUNDERBELLYOFKARACHIArifHasan|DhuhaAlvi|AnumMuftiUpdated27Nov,202211:07amESSAY:APAKISTANIWOMANCOMESOFEThe2022ZeenatHaroonRashidWritingPrizeForWomenwasawardedtoanessaythatthejudgesfeltwas“acompellingmemoir”...SairaMahmoodPublished27Nov,202206:44amFOOTBALL:AWORLDCUPFORSOUTHASIAJustabouteverythinghasbeenquestionedaboutQataraheadoftheFIFAWorldCup.HereishowQataristakingthatcriticismwithUmaidWasimPublished27Nov,202206:44amFIRSTPERSON:THEWARNOONEKNOWSABOUTMohammadKamranJawaidPublished27Nov,202208:09amSOUNDCHECK:RISINGLIKEAWEBayaan’slatestofferingTayraakisanold-schoolrocklullabythathitsyoustraightintheheartBandBajiPublished27Nov,202208:02amTHEGRAPEVINERecentlySajjadAlipleasantlysurprisedhisfans(it’salmostbecomeofahabitofhis)bypostingavideoinwhichheisplayingPYTPublished27Nov,202207:54amBUSINESS&FINANCEDevelopingnewseedvarietiesCryptolessonsfromSultanaDakuTheCatch-22ofgrowthandinflationYOUNGWORLDHabitsthatarebadHowtocorrectthreebadbehiouralhabits!MailboxAURORAKiranaurGeorgekaPakistanWhatisstoppingfull-scaleconversiontodigitalcash?Pakistan’sdigitallendingrevolutionFilmstripHomeSupplementChinaDailyBusinessGWMpresentslatestNEVsatThaimotorshowCultureAncientartifactsunearthedinSouthwestChinaOpinionSunakshouldthinktwicebeforesouringUK-ChinatiesNewspaperFrontPeNoformaltalksorreementwithTTP,saysRanaSanaullahOnekilledinattackonSouthWaziristangirlsschoolZardarispellsoutplantocounter‘dissolution’overturesMalikRiazlatesttobenefitfromNAOtweaksImrantakesCMElahionboardasPTIponders‘dissolution’planReadMore...BackPePlantoscrapmobilecarrierpayments‘postponed’MohsinDawarflaysowngovtover‘civiliansupremacy’GermanycrashoutasJapan,SpainadvanceAmin’sadmissionshakespropertyclaimainstAltafSC‘deviates’fromitspastrulingsonassetdeclarationReadMore...NationalAzamSwatiurgesSCtotransferallcasesainsthimtocapitalGlobalFundcommits$20mtosupporthealthsystems52pcriseinterrorattackssinceregimechange,claimsFawadIHCexplainsreasonforpardoningImranincontemptcaseNewCOASAsimMunirtoappointengineerasISPRheadReadMore...Karachi15thInternationalUrduConferencegetsunderwayTestrunofChinesetraincoachesconductedinKarachiGovtordersarrestoffivesuspectsacquittedinPerweenRahmanmurdercaseSindhAssemblytakesupnolegislativebusinessonprivatemembers’dayUrdutranslationofshortstories,AalmiKahaniyaan,launchedReadMore...LahoreGovernorapprovesthreebillsReplysoughtfromNABonFarhat’schallengepleaChinesefirmtoainoperationliseentirePSCAinfrastructureFaisalabad(Lyallpur)turns118asdistrictPoliceattemptto‘takeover’hospitalbuildinginRahimYarKhanReadMore...Islamabad3ANFofficialssuspendedaftervideoemergesofthemallegedlytakingbribesatIslamabadairportElectioneeringforIslamabadLGpollsgatherspaceIHCaskspolicetolearninvestigationtechniqueCrashlandingsimulatedaspartofrescueexerciseModerntechniquescanimprovedefenceघर - दूर. COMproduction:PresidentArifAlviReadMore...PeshawarPoliceconstablemartyredinCharsaddaattackCMMahmoodKhansayshe’llinstantlydissolveassemblyonImran’sordersFourminerswhodiedinOrakzaiburiedinShanglaPeshawaradminbansholdingofprotestsonKhyberRoadContractorsthreatentostoprationsupplytoprisonsReadMore...BusinessExportsshrinkforthirdmonthinarowInflationslows,butremainsatmulti-yearhighsReservesdown4.2pc;rupeegainsHascolseekscreditors’consenttoloanrestructuring11-membercommissionsetuptoadviseonresourcemobilisationReadMore...SportBelgiumcrashoutaftergoallessdrawwithModric’sCroatiaGhanaplayersmustbereadytosacrificethemselvesatWorldCup,sayscoachZiyech,En-NesyriscoreasMoroccoroarpastCanadaintolast16‘SerbiahopingforholesinSwissdefences,likeintheircheese’‘Bazball’continuesasEnglandsmashrecord-breaking506-4onfirstdayReadMore...EditorialWaywardideologyProgressivestanceChinaCovidprotestsPunjabcrisisQuettaattackReadMore...ColumnOurDutchdiseaseKarachistreetcrimeAbeautifulmindProductiveconflictExploitingclimatediplomacyReadMore...InternationalMacronraisessubsidiesforUSgoodsatsummitwithBidenMuskhopefulofinterfaceimplantsinhumanbrainswithinsixmonthsLetterbombwetargetsSpanishPM,USembassyUNurgesTalibantoinvestigatereportsofextrajudicialkillingsUNlaunchesrecord$51.5bnemergencyfundingappealReadMore...SundayMazineEPICURIOUS:THEGINGERBREADVILLEGOLF:PAKISTAN’SSOARINGELESSOCIETY:INSPIRINGINCLUSIVITY,ONEPOSTATATIMEABATTLEOFTHESEXESAMIDSCALPELSANDSUTURESHEALTH:VOICESFROMTHEFRONTLINESReadMore...Books&AuthorsNON-FICTION:PUSHEDINTOWARFICTION:HOTANDDEPRESSEDFICTION:PATHORPASSE?COLUMN:THEFLIGHTOFTHEMOTHBOOKSINBRIEFReadMore...Business&FinanceDevelopingnewseedvarietiesCryptolessonsfromSultanaDakuTheCatch-22ofgrowthandinflationBuildersinflatepricesofflatsGrowinggarlicReadMore...YoungWorldHabitsthatarebadHowtocorrectthreebadbehiouralhabits!MailboxPoet'sCornerStorytime:AgooddeednevergoesinvainReadMore...DAWN.COMCompunode.comPvt.Ltd.().DesignedforDawn.ContactTermsofUseReproductionsContributionGuidelinesPrivacyCommentModerationCodeofEthicsSocialMediaPolicySubscribetoNewspaperAdvertiseonDawn.comSponsoredContentClassifiedsObituariesPrayerTimingsStock/Forex/घर - दूर. COMGoldWeatherDawnHeraldAuroraPrismDawnNewsImesEos/Icon/YoungWorldCityfm89Teeli©2022,DawnScribePublishingPlatform_atrk_opts={atrk_acct:"1DJ3k1acFH00UN",domain:"dawn.com",dynamic:true};(function(){varas=document.createElement('script');as.type='text/jascript';as.async=true;as.src="d31qbv1cthcecs.cloudfront.net/atrk.js";vars=document.getElementsByTName('script')[0];s.parentNode.insertBefore(as,s);})();functionsendInteractiveEvent(category,label){if(!googleMeasurement){ga("send",{hitType:"event",eventCategory:category,eventAction:"click",eventLabel:label});}else{if("undefined"!=typeofgt){gt("event","click",{'event_category':category,'event_label':label});}}}vareventItems=[{"selector":".widget-linkedimea","parent":"linkedime"},{"selector":".widget-linkedimea","parent":"linkedime"}];vargoogleMeasurement=true;document.querySelector("html").addEventListener("click",function(e){//github.com/aleemb/dawn.com/issues/1165if(window.Element&&Element.prototype.closest){vartarget=e.target;vareventLabel=typeoftarget.href!=="undefined"&&!target.href.startsWith("jascript:")?target.href:document.location.href;for(i=0;isendInteractiveEvent('audio',e.type),false);audioPlayer.addEventListener("ended",(e)=>sendInteractiveEvent('audio',e.type),false);}}document.addEventListener("DOMContentLoaded",function(){Counter.count([{"category":"Home"}]);});varOneSignal=window.OneSignal||[];OneSignal.push(["init",{appId:"daa-a849-47c0-96e7-4b956b56f35e",/*Settotruetoautomaticallypromptvisitors*/autoRegister:true,//documentation.onesignal.com/docs/customize-permission-messes-1notifyButton:{text:{'tip.state.unsubscribed':'Subscribetonotifications','tip.state.subscribed':"You'resubscribedtonotifications",'tip.state.blocked':"You'veblockednotifications",'messe.prenotify':'Clicktosubscribetonotifications','messe.action.subscribed':"Thanksforsubscribing!",'messe.action.resubscribed':"You'resubscribedtonotifications",'messe.action.unsubscribed':"Youwon'treceivenotificationsain",'dialog.main.title':'ManeSiteNotifications','dialog.main.button.subscribe':'SUBSCRIBE','dialog.main.button.unsubscribe':'UNSUBSCRIBE','dialog.blocked.title':'UnblockNotifications','dialog.blocked.messe':"Followtheseinstructionstoallownotifications:"},/*Settofalsetohide*/enable:false},prenotify:true,persistNotification:false,showCredit:false,//YourotherinitoptionsherepromptOptions:{/*Changeboldtitle,limitedto30characters*/siteName:"Dawn.Com",/*Subtitle,limitedto90characters*/actionMesse:"We'dliketoshowyounotificationsforthelatestnewsandupdates.",/*Examplenotificationtitle*/exampleNotificationTitle:'Subscribefornewsupdates',/*Examplenotificationmesse*/exampleNotificationMesse:"",/*Textbelowexamplenotification,limitedto50characters*/exampleNotificationCaption:'Youcanunsubscribeanytime',/*Acceptbuttontext,limitedto15characters*/acceptButtonText:"ALLOW",/*Cancelbuttontext,limitedto15characters*/cancelButtonText:"NOTHANKS"}}]);//OneSignal.setSubscription(true);OneSignal.push(function(){//forcefullypopupfornotificationsubscription//OneSignal.registerForPushNotifications();//fordebugging//OneSignal.log.setLevel('trace');/*OneSignal.isPushNotificationsEnabled(function(isEnabled){if(isEnabled){console.log("Pushnotificationsareenabled!");}else{console.log("Pushnotificationsarenotenabledyet.");}});*/});

साइट:घर - दूर. COMरिपोर्ट good

यदि साइट का उल्लंघन है, तो कृपया रिपोर्ट पर क्लिक करेंरिपोर्ट good

अनुशंसित सूचना

अनुशंसित साइट